PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010088238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family MYB
Protein Properties Length: 418aa    MW: 46562.9 Da    PI: 7.1201
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010088238.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.6e-153885148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
   XP_010088238.1 38 KGLWSPEEDEKLMRYMLSNGQGCWSDIARNAGLQRCGKSCRLRWINYL 85
                     678*******************************************97 PP

2Myb_DNA-binding41.92.4e-1391150147
                      TSSS-HHHHHHHHHHHHHTTTT..............-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............tWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ +E++l+++++ +lG++               W+ Ia++++ gRt++++k++w++ 
   XP_010088238.1  91 RGAFSSQEEDLIIHLHSLLGNRplviikslgpfhieMWSQIAARLP-GRTDNEIKNFWNST 150
                      89********************************************.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.153389IPR017930Myb domain
SuperFamilySSF466893.63E-2336147IPR009057Homeodomain-like
SMARTSM007174.1E-113787IPR001005SANT/Myb domain
PfamPF002491.3E-133885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-233992IPR009057Homeodomain-like
CDDcd001679.71E-104185No hitNo description
SMARTSM007178.5E-1090153IPR001005SANT/Myb domain
PROSITE profilePS5129412.09390155IPR017930Myb domain
PfamPF002491.2E-1191150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-2293156IPR009057Homeodomain-like
CDDcd001671.03E-793151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MRKPSDHPRT SSISMSGVVS DKKNIAIGNK NIINKLRKGL WSPEEDEKLM RYMLSNGQGC  60
WSDIARNAGL QRCGKSCRLR WINYLRPDLK RGAFSSQEED LIIHLHSLLG NRPLVIIKSL  120
GPFHIEMWSQ IAARLPGRTD NEIKNFWNST LKKRLKHLNN STSSSSPNDS NSSAEQPTDH  180
HHRHVKIDGH DPTIISMQYG DGHDHRHHMM IMASAVHMDS SCSSSTISLQ ASTNSTTACG  240
GTGTGNNYQF DPFYNVLGHY SRHDMSHADS NLFNVMPSAC LSQVGGFDDH DRVSLGPDYG  300
VLEEYGKMAG QLEIRDFSLI PPLESRISNN NNIEENKNNS IAPIDHIKGN SSSTIMSSAY  360
NNHNNNNNHL MNNYSSGGIL GFGSNIGQLQ GENLKMGEWD LEGLIQDISS FPFLDFQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-23151551128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088238.10.0Transcription factor
TrEMBLW9R0X10.0W9R0X1_9R
STRINGGLYMA19G05080.16e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.12e-65myb domain protein 83